Lineage for d1m34l_ (1m34 L:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321573Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 321596Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 321621Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  6. 321661Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  7. 321662Species Azotobacter vinelandii [TaxId:354] [81397] (10 PDB entries)
  8. 321676Domain d1m34l_: 1m34 L: [78526]
    Other proteins in same PDB: d1m34a_, d1m34c_, d1m34e_, d1m34f_, d1m34g_, d1m34h_, d1m34i_, d1m34k_, d1m34m_, d1m34n_, d1m34o_, d1m34p_
    complexed with adp, alf, ca, cfm, clf, fs4, hca, mg

Details for d1m34l_

PDB Entry: 1m34 (more details), 2.3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate

SCOP Domain Sequences for d1m34l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m34l_ c.92.2.3 (L:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1m34l_:

Click to download the PDB-style file with coordinates for d1m34l_.
(The format of our PDB-style files is described here.)

Timeline for d1m34l_: