Lineage for d1m34f_ (1m34 F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1595958Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1596165Protein Nitrogenase iron protein [52661] (2 species)
  7. 1596166Species Azotobacter vinelandii [TaxId:354] [52662] (20 PDB entries)
  8. 1596178Domain d1m34f_: 1m34 F: [78520]
    Other proteins in same PDB: d1m34a_, d1m34b_, d1m34c_, d1m34d_, d1m34i_, d1m34j_, d1m34k_, d1m34l_
    complexed with adp, alf, ca, cfm, clf, hca, mg, sf4

Details for d1m34f_

PDB Entry: 1m34 (more details), 2.3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate
PDB Compounds: (F:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1m34f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m34f_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

SCOPe Domain Coordinates for d1m34f_:

Click to download the PDB-style file with coordinates for d1m34f_.
(The format of our PDB-style files is described here.)

Timeline for d1m34f_: