Lineage for d1m31a_ (1m31 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323270Protein Calcyclin (S100) [47479] (17 species)
  7. 2323389Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries)
    MTS1 protein
  8. 2323432Domain d1m31a_: 1m31 A: [78506]

Details for d1m31a_

PDB Entry: 1m31 (more details)

PDB Description: three-dimensional solution structure of apo-mts1
PDB Compounds: (A:) Placental calcium-binding protein

SCOPe Domain Sequences for d1m31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m31a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
nldsnrdnevdfqeycvflsciammcneffegfpdkqprkk

SCOPe Domain Coordinates for d1m31a_:

Click to download the PDB-style file with coordinates for d1m31a_.
(The format of our PDB-style files is described here.)

Timeline for d1m31a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m31b_