Lineage for d1m2wa2 (1m2w A:1-192)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309007Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 309070Protein Mannitol 2-dehydrogenase [82301] (1 species)
  7. 309071Species Pseudomonas fluorescens [TaxId:294] [82302] (2 PDB entries)
  8. 309073Domain d1m2wa2: 1m2w A:1-192 [78503]
    Other proteins in same PDB: d1m2wa1, d1m2wb1

Details for d1m2wa2

PDB Entry: 1m2w (more details), 1.8 Å

PDB Description: Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and D-mannitol

SCOP Domain Sequences for d1m2wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2wa2 c.2.1.6 (A:1-192) Mannitol 2-dehydrogenase {Pseudomonas fluorescens}
mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
ipaftvmscdnl

SCOP Domain Coordinates for d1m2wa2:

Click to download the PDB-style file with coordinates for d1m2wa2.
(The format of our PDB-style files is described here.)

Timeline for d1m2wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m2wa1