![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (10 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Mannitol 2-dehydrogenase [82301] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [82302] (2 PDB entries) |
![]() | Domain d1m2wa2: 1m2w A:1-192 [78503] Other proteins in same PDB: d1m2wa1, d1m2wb1 |
PDB Entry: 1m2w (more details), 1.8 Å
SCOP Domain Sequences for d1m2wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2wa2 c.2.1.6 (A:1-192) Mannitol 2-dehydrogenase {Pseudomonas fluorescens} mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag ipaftvmscdnl
Timeline for d1m2wa2: