Lineage for d1m2vb5 (1m2v B:216-300)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751299Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 751300Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 751306Protein Sec24 [82923] (1 species)
  7. 751307Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)
  8. 751311Domain d1m2vb5: 1m2v B:216-300 [78501]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4
    complexed with zn

Details for d1m2vb5

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer
PDB Compounds: (B:) protein transport protein SEC24

SCOP Domain Sequences for d1m2vb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2vb5 g.41.10.1 (B:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

SCOP Domain Coordinates for d1m2vb5:

Click to download the PDB-style file with coordinates for d1m2vb5.
(The format of our PDB-style files is described here.)

Timeline for d1m2vb5: