Lineage for d1m2vb4 (1m2v B:754-926)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261128Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 261209Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 261210Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 protein domains)
  6. 261216Protein Sec24 [82758] (1 species)
  7. 261217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (1 PDB entry)
  8. 261218Domain d1m2vb4: 1m2v B:754-926 [78500]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb5
    complexed with zn

Details for d1m2vb4

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2vb4:

Sequence, based on SEQRES records: (download)

>d1m2vb4 d.109.2.1 (B:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg
gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi
vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

Sequence, based on observed residues (ATOM records): (download)

>d1m2vb4 d.109.2.1 (B:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpgtivlpqpinatsslferyglylidngnelflwmggdavpalvf
fnqrvrniinqlrnhddvityqslyivrarevatlrlwasstlvedkilnnesyreflqi
mkarisk

SCOP Domain Coordinates for d1m2vb4:

Click to download the PDB-style file with coordinates for d1m2vb4.
(The format of our PDB-style files is described here.)

Timeline for d1m2vb4: