Lineage for d1m2vb1 (1m2v B:647-753)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283053Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 283059Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) (S)
  5. 283060Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)
  6. 283066Protein Sec24 [81815] (1 species)
  7. 283067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (1 PDB entry)
  8. 283068Domain d1m2vb1: 1m2v B:647-753 [78497]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2vb1

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2vb1 a.71.2.1 (B:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan
lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

SCOP Domain Coordinates for d1m2vb1:

Click to download the PDB-style file with coordinates for d1m2vb1.
(The format of our PDB-style files is described here.)

Timeline for d1m2vb1: