Class g: Small proteins [56992] (85 folds) |
Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) |
Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins) |
Protein Sec23 [82921] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (2 PDB entries) |
Domain d1m2va5: 1m2v A:45-119 [78496] Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5 complexed with zn |
PDB Entry: 1m2v (more details), 2.75 Å
SCOP Domain Sequences for d1m2va5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2va5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple lqsttieyitnkpvt
Timeline for d1m2va5: