Lineage for d1m2va5 (1m2v A:45-119)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524497Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 524498Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 524499Protein Sec23 [82921] (1 species)
  7. 524500Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (2 PDB entries)
  8. 524503Domain d1m2va5: 1m2v A:45-119 [78496]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va4, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5

Details for d1m2va5

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2va5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2va5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple
lqsttieyitnkpvt

SCOP Domain Coordinates for d1m2va5:

Click to download the PDB-style file with coordinates for d1m2va5.
(The format of our PDB-style files is described here.)

Timeline for d1m2va5: