Lineage for d1m2od_ (1m2o D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846846Protein SAR1 [69483] (3 species)
  7. 1846847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (2 PDB entries)
  8. 1846850Domain d1m2od_: 1m2o D: [78491]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5
    complexed with sec23
    complexed with gnp, mg, zn

Details for d1m2od_

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (D:) GTP-binding protein SAR1

SCOPe Domain Sequences for d1m2od_:

Sequence, based on SEQRES records: (download)

>d1m2od_ c.37.1.8 (D:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsq

Sequence, based on observed residues (ATOM records): (download)

>d1m2od_ c.37.1.8 (D:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgrpvevfmcsvvmrngyleafqwlsq

SCOPe Domain Coordinates for d1m2od_:

Click to download the PDB-style file with coordinates for d1m2od_.
(The format of our PDB-style files is described here.)

Timeline for d1m2od_: