Lineage for d1m2oc5 (1m2o C:45-119)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 625029Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 625030Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 625031Protein Sec23 [82921] (1 species)
  7. 625032Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (2 PDB entries)
  8. 625034Domain d1m2oc5: 1m2o C:45-119 [78490]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oc5

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex

SCOP Domain Sequences for d1m2oc5:

Sequence, based on SEQRES records: (download)

>d1m2oc5 g.41.10.1 (C:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple
lqsttieyitnkpvt

Sequence, based on observed residues (ATOM records): (download)

>d1m2oc5 g.41.10.1 (C:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnenmplelqs
ttieyitnkpvt

SCOP Domain Coordinates for d1m2oc5:

Click to download the PDB-style file with coordinates for d1m2oc5.
(The format of our PDB-style files is described here.)

Timeline for d1m2oc5: