![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) ![]() |
![]() | Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins) |
![]() | Protein Sec23 [82756] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (3 PDB entries) |
![]() | Domain d1m2oc4: 1m2o C:627-765 [78489] Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc5, d1m2od_ complexed with gnp, mg, zn |
PDB Entry: 1m2o (more details), 2.5 Å
SCOPe Domain Sequences for d1m2oc4:
Sequence, based on SEQRES records: (download)
>d1m2oc4 d.109.2.1 (C:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl tddvslqnfmthlqqvavs
>d1m2oc4 d.109.2.1 (C:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpstivltddvslqnfmt hlqqvavs
Timeline for d1m2oc4: