Lineage for d1m2oc3 (1m2o C:120-390)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2129081Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 protein domains)
    automatically mapped to Pfam PF04811
  6. 2129082Protein Sec23 [82459] (1 species)
  7. 2129083Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82460] (3 PDB entries)
  8. 2129086Domain d1m2oc3: 1m2o C:120-390 [78488]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc4, d1m2oc5, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oc3

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (C:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oc3:

Sequence, based on SEQRES records: (download)

>d1m2oc3 c.62.1.2 (C:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkptgpggaashlpnamnkvtpfslnrfflpleqvefkln
qllenlspdqwsvpaghrplratgsalniaslllqgcyknipariilfasgpgtvapgli
vnselkdplrshhdidsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemk
qltdstggvllltdafstaifkqsylrlfak

Sequence, based on observed residues (ATOM records): (download)

>d1m2oc3 c.62.1.2 (C:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkptvtpfslnrfflpleqvefklnqllenlspdqwsvpa
ghrplratgsalniaslllqgcyknipariilfasgpgtvapglivnselkdplrshhdi
dsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemkqltdstggvllltda
fstaifkqsylrlfak

SCOPe Domain Coordinates for d1m2oc3:

Click to download the PDB-style file with coordinates for d1m2oc3.
(The format of our PDB-style files is described here.)

Timeline for d1m2oc3: