Lineage for d1m2oc2 (1m2o C:2-44,C:391-523)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2378315Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 2378316Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)
  6. 2378317Protein Sec23 [81997] (1 species)
  7. 2378318Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81998] (3 PDB entries)
  8. 2378320Domain d1m2oc2: 1m2o C:2-44,C:391-523 [78487]
    Other proteins in same PDB: d1m2oa1, d1m2oa3, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc3, d1m2oc4, d1m2oc5, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oc2

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (C:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oc2:

Sequence, based on SEQRES records: (download)

>d1m2oc2 b.2.8.1 (C:2-44,C:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeianta
ansnpmmsapgsadrphlaytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

Sequence, based on observed residues (ATOM records): (download)

>d1m2oc2 b.2.8.1 (C:2-44,C:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeianth
laytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

SCOPe Domain Coordinates for d1m2oc2:

Click to download the PDB-style file with coordinates for d1m2oc2.
(The format of our PDB-style files is described here.)

Timeline for d1m2oc2: