Lineage for d1m2oc1 (1m2o C:524-626)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739455Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 1739475Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) (S)
    automatically mapped to Pfam PF04815
  5. 1739476Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)
  6. 1739477Protein Sec23 [81813] (1 species)
  7. 1739478Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81814] (3 PDB entries)
  8. 1739481Domain d1m2oc1: 1m2o C:524-626 [78486]
    Other proteins in same PDB: d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oc1

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (C:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2oc1 a.71.2.1 (C:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqeaaavlmariavhkaetddgadvirwldrtliklcqkyadynkddpqsfrlapnfsly
pqftyylrrsqflsvfnnspdetafyrhiftredttnslimiq

SCOPe Domain Coordinates for d1m2oc1:

Click to download the PDB-style file with coordinates for d1m2oc1.
(The format of our PDB-style files is described here.)

Timeline for d1m2oc1: