Class a: All alpha proteins [46456] (286 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) automatically mapped to Pfam PF04815 |
Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins) |
Protein Sec23 [81813] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81814] (3 PDB entries) |
Domain d1m2oc1: 1m2o C:524-626 [78486] Other proteins in same PDB: d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5, d1m2od_ complexed with gnp, mg, zn |
PDB Entry: 1m2o (more details), 2.5 Å
SCOPe Domain Sequences for d1m2oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2oc1 a.71.2.1 (C:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqeaaavlmariavhkaetddgadvirwldrtliklcqkyadynkddpqsfrlapnfsly pqftyylrrsqflsvfnnspdetafyrhiftredttnslimiq
Timeline for d1m2oc1: