| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein SAR1 [69483] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (1 PDB entry) |
| Domain d1m2ob_: 1m2o B: [78485] Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5 |
PDB Entry: 1m2o (more details), 2.5 Å
SCOP Domain Sequences for d1m2ob_:
Sequence, based on SEQRES records: (download)
>d1m2ob_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae)}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsqyi
>d1m2ob_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae)}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgiegqrpvevfmcsvvmrngyleafqwlsqyi
Timeline for d1m2ob_: