Lineage for d1m2oa5 (1m2o A:45-119)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966733Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 1966734Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 1966735Protein Sec23 [82921] (1 species)
  7. 1966736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (3 PDB entries)
  8. 1966738Domain d1m2oa5: 1m2o A:45-119 [78484]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oa5

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oa5:

Sequence, based on SEQRES records: (download)

>d1m2oa5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple
lqsttieyitnkpvt

Sequence, based on observed residues (ATOM records): (download)

>d1m2oa5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnenmplelqs
ttieyitnkpvt

SCOPe Domain Coordinates for d1m2oa5:

Click to download the PDB-style file with coordinates for d1m2oa5.
(The format of our PDB-style files is described here.)

Timeline for d1m2oa5: