Lineage for d1m2oa4 (1m2o A:627-765)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731406Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 731565Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 731566Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 731567Protein Sec23 [82756] (1 species)
  7. 731568Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (2 PDB entries)
  8. 731569Domain d1m2oa4: 1m2o A:627-765 [78483]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc5, d1m2od_

Details for d1m2oa4

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (A:) protein transport protein SEC23

SCOP Domain Sequences for d1m2oa4:

Sequence, based on SEQRES records: (download)

>d1m2oa4 d.109.2.1 (A:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl
tddvslqnfmthlqqvavs

Sequence, based on observed residues (ATOM records): (download)

>d1m2oa4 d.109.2.1 (A:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpstivltddvslqnfmt
hlqqvavs

SCOP Domain Coordinates for d1m2oa4:

Click to download the PDB-style file with coordinates for d1m2oa4.
(The format of our PDB-style files is described here.)

Timeline for d1m2oa4: