Lineage for d1m2ea_ (1m2e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101955Family c.23.1.5: N-terminal domain of the circadian clock protein KaiA [82344] (1 protein)
    lacks canonical receiver domains features
  6. 2101956Protein N-terminal domain of the circadian clock protein KaiA [82345] (1 species)
  7. 2101957Species Synechococcus elongatus [TaxId:32046] [82346] (3 PDB entries)
    Uniprot Q79PF6
  8. 2101960Domain d1m2ea_: 1m2e A: [78478]
    CASP5

Details for d1m2ea_

PDB Entry: 1m2e (more details)

PDB Description: Solution structure of the N-terminal domain of Synechococcus elongatus KaiA (KaiA135N); Average minimized structure.
PDB Compounds: (A:) KaiA

SCOPe Domain Sequences for d1m2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ea_ c.23.1.5 (A:) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]}
mlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
psfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlpyqvda
alaeflrlapvetma

SCOPe Domain Coordinates for d1m2ea_:

Click to download the PDB-style file with coordinates for d1m2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ea_: