SCOPe 2.06: Domain d1m2bb_: 1m2b B:

Lineage for d1m2bb_ (1m2b B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.11: Thioredoxin-like 2Fe-2S ferredoxin [52918] (1 protein)

6. Protein Thioredoxin-like 2Fe-2S ferredoxin [52919] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [52920] (4 PDB entries)

8. Domain d1m2bb_: 1m2b B: [78475]
   complexed with fes

Details for d1m2bb_

PDB Entry: 1m2b, 1.25 Å

PDB Description: crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus

PDB Compounds: (B:) [2Fe-2S] ferredoxin

SCOPe Domain Sequences for d1m2bb_:

Sequence; same for both SEQRES and ATOM records:

>d1m2bb_ c.47.1.11 (B:) Thioredoxin-like 2Fe-2S ferredoxin {Aquifex aeolicus [TaxId: 63363]}
fkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgsmnacmmg
pvvvvypdgvwygqvkpedvdeivekhlkggepverlvisk

Timeline for d1m2bb_:

• d1m2bb_ first appeared in SCOP 1.63
  
• d1m2bb_ appears in SCOPe 2.05
  
• d1m2bb_ appears in SCOPe 2.07
  
• d1m2bb_ appears in the current release, SCOPe 2.08