Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.11: Thioredoxin-like 2Fe-2S ferredoxin [52918] (1 protein) |
Protein Thioredoxin-like 2Fe-2S ferredoxin [52919] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [52920] (4 PDB entries) |
Domain d1m2ba_: 1m2b A: [78474] complexed with fes |
PDB Entry: 1m2b (more details), 1.25 Å
SCOPe Domain Sequences for d1m2ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2ba_ c.47.1.11 (A:) Thioredoxin-like 2Fe-2S ferredoxin {Aquifex aeolicus [TaxId: 63363]} fkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgsmnacmmg pvvvvypdgvwygqvkpedvdeivekhlkggepverlvisk
Timeline for d1m2ba_: