Lineage for d1m2ba_ (1m2b A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 245365Family c.47.1.11: Thioredoxin-like 2Fe-2S ferredoxin [52918] (1 protein)
  6. 245366Protein Thioredoxin-like 2Fe-2S ferredoxin [52919] (1 species)
  7. 245367Species Aquifex aeolicus [TaxId:63363] [52920] (4 PDB entries)
  8. 245370Domain d1m2ba_: 1m2b A: [78474]

Details for d1m2ba_

PDB Entry: 1m2b (more details), 1.25 Å

PDB Description: crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus

SCOP Domain Sequences for d1m2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ba_ c.47.1.11 (A:) Thioredoxin-like 2Fe-2S ferredoxin {Aquifex aeolicus}
fkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgsmnacmmg
pvvvvypdgvwygqvkpedvdeivekhlkggepverlvisk

SCOP Domain Coordinates for d1m2ba_:

Click to download the PDB-style file with coordinates for d1m2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ba_: