Class b: All beta proteins [48724] (165 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) |
Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins) |
Protein Jacalin [51103] (2 species) |
Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries) |
Domain d1m26.4: 1m26 H:,G: [78471] complexed with gal, nga |
PDB Entry: 1m26 (more details), 1.62 Å
SCOP Domain Sequences for d1m26.4:
Sequence; same for both SEQRES and ATOM records: (download)
>g1m26.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf nlpienglivgfkgsigywldyfsmylsl
Timeline for d1m26.4: