Lineage for d1m26.4 (1m26 H:,G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676676Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 676694Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 676695Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)
  6. 676750Protein Jacalin [51103] (2 species)
  7. 676760Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 676765Domain d1m26.4: 1m26 H:,G: [78471]
    complexed with gal, nga

Details for d1m26.4

PDB Entry: 1m26 (more details), 1.62 Å

PDB Description: crystal structure of jacalin-t-antigen complex
PDB Compounds: (G:) Jacalin, alpha chain, (H:) Jacalin, beta chain

SCOP Domain Sequences for d1m26.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1m26.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOP Domain Coordinates for d1m26.4:

Click to download the PDB-style file with coordinates for d1m26.4.
(The format of our PDB-style files is described here.)

Timeline for d1m26.4: