Lineage for d1m22a_ (1m22 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150433Protein Peptide amidase Pam [82529] (1 species)
  7. 2150434Species Stenotrophomonas maltophilia [TaxId:40324] [82530] (2 PDB entries)
  8. 2150435Domain d1m22a_: 1m22 A: [78464]
    complexed with epe

Details for d1m22a_

PDB Entry: 1m22 (more details), 1.4 Å

PDB Description: X-ray structure of native peptide amidase from Stenotrophomonas maltophilia at 1.4 A
PDB Compounds: (A:) peptide amidase

SCOPe Domain Sequences for d1m22a_:

Sequence, based on SEQRES records: (download)

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}
pfpyaetdvadlqarmtageldsttltqaylqriaaldrtgprlravielnpdalkeaae
rdrerrdgrlrgplhgiplllkdninaapmatsagslalqgfrpddaylvrrlrdagavv
lgktnlsewanfrgndsisgwsarggqtrnpyrishspcgsssgsavavaanlasvaigt
etdgsivcpaaingvvglkptvglvsrdgiipisfsqdtagpmarsvadaaavltaiagr
ddadpatatmpgravydytarldpqglrgkrigllqtpllkyrgmpplieqaatelrrag
avvvpvelpnqgawaeaertlllyefkagleryfnthraplrsladliafnqahskqelg
lfgqellveadatagladpayirarsdarrlagpegidaalaahqldalvapttgvawpi
rsegddfpgesysaaavagypsltvpmgqidglpvgllfmgtawsepkliemayayeqrt
rarrpphfdt

Sequence, based on observed residues (ATOM records): (download)

>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}
pfpyaetdvadlqarmtageldsttltqaylqriaaldrtgprlravielnpdalkeaae
rdrerrdgrlrgplhgiplllkdninaapmatsagslalqgfrpddaylvrrlrdagavv
lgktnlsewanfrgndsisgwsarggqtrnpyrishspcgsssgsavavaanlasvaigt
etdgsivcpaaingvvglkptvglvsrdgiipisfsqdtagpmarsvadaaavltaiagr
ddadpatatmpgravydytarldpqglrgkrigllqtpllkyrgmpplieqaatelrrag
avvvpvelpnqgawaeaertlllyefkagleryfnthraplrsladliafnqahskqelg
lfgqellveadatagladpayirarsdarrlagpegidaalaahqldalvapttgvawpi
rsdfpgesysaaavagypsltvpmgqidglpvgllfmgtawsepkliemayayeqrtrar
rpphfdt

SCOPe Domain Coordinates for d1m22a_:

Click to download the PDB-style file with coordinates for d1m22a_.
(The format of our PDB-style files is described here.)

Timeline for d1m22a_: