SCOPe 2.06: Domain d1m21b_: 1m21 B:

Lineage for d1m21b_ (1m21 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
   possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family)
   automatically mapped to Pfam PF01425

5. Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)

6. Protein Peptide amidase Pam [82529] (1 species)

7. Species Stenotrophomonas maltophilia [TaxId:40324] [82530] (2 PDB entries)

8. Domain d1m21b_: 1m21 B: [78463]

Details for d1m21b_

PDB Entry: 1m21, 1.8 Å

PDB Description: Crystal structure analysis of the peptide amidase PAM in complex with the competitive inhibitor chymostatin

PDB Compounds: (B:) peptide amidase

SCOPe Domain Sequences for d1m21b_:

Sequence; same for both SEQRES and ATOM records:

>d1m21b_ c.117.1.1 (B:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}
fpyaetdvadlqarmtageldsttltqaylqriaaldrtgprlravielnpdalkeaaer
drerrdgrlrgplhgiplllkdninaapmatsagslalqgfrpddaylvrrlrdagavvl
gktnlsewanfrgndsisgwsarggqtrnpyrishspcgsssgsavavaanlasvaigte
tdgsivcpaaingvvglkptvglvsrdgiipisfsqdtagpmarsvadaaavltaiagrd
dadpatatmpgravydytarldpqglrgkrigllqtpllkyrgmpplieqaatelrraga
vvvpvelpnqgawaeaertlllyefkagleryfnthraplrsladliafnqahskqelgl
fgqellveadatagladpayirarsdarrlagpegidaalaahqldalvapttgvawpir
segddfpgesysaaavagypsltvpmgqidglpvgllfmgtawsepkliemayayeqrtr
arrpphf

Timeline for d1m21b_:

• d1m21b_ first appeared in SCOP 1.63
  
• d1m21b_ appears in SCOPe 2.05
  
• d1m21b_ appears in SCOPe 2.07
  
• d1m21b_ appears in the current release, SCOPe 2.08