Lineage for d1m21a_ (1m21 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150433Protein Peptide amidase Pam [82529] (1 species)
  7. 2150434Species Stenotrophomonas maltophilia [TaxId:40324] [82530] (2 PDB entries)
  8. 2150437Domain d1m21a_: 1m21 A: [78462]

Details for d1m21a_

PDB Entry: 1m21 (more details), 1.8 Å

PDB Description: Crystal structure analysis of the peptide amidase PAM in complex with the competitive inhibitor chymostatin
PDB Compounds: (A:) peptide amidase

SCOPe Domain Sequences for d1m21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m21a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]}
fpyaetdvadlqarmtageldsttltqaylqriaaldrtgprlravielnpdalkeaaer
drerrdgrlrgplhgiplllkdninaapmatsagslalqgfrpddaylvrrlrdagavvl
gktnlsewanfrgndsisgwsarggqtrnpyrishspcgsssgsavavaanlasvaigte
tdgsivcpaaingvvglkptvglvsrdgiipisfsqdtagpmarsvadaaavltaiagrd
dadpatatmpgravydytarldpqglrgkrigllqtpllkyrgmpplieqaatelrraga
vvvpvelpnqgawaeaertlllyefkagleryfnthraplrsladliafnqahskqelgl
fgqellveadatagladpayirarsdarrlagpegidaalaahqldalvapttgvawpir
segddfpgesysaaavagypsltvpmgqidglpvgllfmgtawsepkliemayayeqrtr
arrpphf

SCOPe Domain Coordinates for d1m21a_:

Click to download the PDB-style file with coordinates for d1m21a_.
(The format of our PDB-style files is described here.)

Timeline for d1m21a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m21b_