Lineage for d1m1yn_ (1m1y N:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243628Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 243741Protein Nitrogenase iron protein [52661] (2 species)
  7. 243742Species Azotobacter vinelandii [TaxId:354] [52662] (11 PDB entries)
  8. 243782Domain d1m1yn_: 1m1y N: [78454]
    Other proteins in same PDB: d1m1ya_, d1m1yb_, d1m1yc_, d1m1yd_, d1m1yi_, d1m1yj_, d1m1yk_, d1m1yl_

Details for d1m1yn_

PDB Entry: 1m1y (more details), 3.2 Å

PDB Description: chemical crosslink of nitrogenase mofe protein and fe protein

SCOP Domain Sequences for d1m1yn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1yn_ c.37.1.10 (N:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOP Domain Coordinates for d1m1yn_:

Click to download the PDB-style file with coordinates for d1m1yn_.
(The format of our PDB-style files is described here.)

Timeline for d1m1yn_: