Lineage for d1m1yf_ (1m1y F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869228Protein Nitrogenase iron protein [52661] (3 species)
  7. 2869232Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries)
  8. 2869280Domain d1m1yf_: 1m1y F: [78446]
    Other proteins in same PDB: d1m1ya_, d1m1yb_, d1m1yc_, d1m1yd_, d1m1yi_, d1m1yj_, d1m1yk_, d1m1yl_
    chemically crosslinked structure
    complexed with ca, cfm, clf, hca, sf4

Details for d1m1yf_

PDB Entry: 1m1y (more details), 3.2 Å

PDB Description: chemical crosslink of nitrogenase mofe protein and fe protein
PDB Compounds: (F:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1m1yf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1yf_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOPe Domain Coordinates for d1m1yf_:

Click to download the PDB-style file with coordinates for d1m1yf_.
(The format of our PDB-style files is described here.)

Timeline for d1m1yf_: