| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein Nitrogenase iron protein [52661] (3 species) |
| Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries) |
| Domain d1m1yf_: 1m1y F: [78446] Other proteins in same PDB: d1m1ya_, d1m1yb_, d1m1yc_, d1m1yd_, d1m1yi_, d1m1yj_, d1m1yk_, d1m1yl_ chemically crosslinked structure complexed with ca, cfm, clf, hca, sf4 |
PDB Entry: 1m1y (more details), 3.2 Å
SCOPe Domain Sequences for d1m1yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1yf_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
Timeline for d1m1yf_: