Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species) |
Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries) Uniprot P07097 |
Domain d1m1td1: 1m1t D:1-268 [78439] Other proteins in same PDB: d1m1ta2, d1m1tb2, d1m1tc2, d1m1td2 complexed with gol, so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m1t (more details), 1.94 Å
SCOPe Domain Sequences for d1m1td1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1td1 c.95.1.1 (D:1-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]} stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa geganparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt vtagnasglndgaaaallmseaeasrrg
Timeline for d1m1td1: