Lineage for d1m1tc1 (1m1t C:1-268)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916808Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)
  7. 2916809Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
    Uniprot P07097
  8. 2916848Domain d1m1tc1: 1m1t C:1-268 [78437]
    Other proteins in same PDB: d1m1ta2, d1m1tb2, d1m1tc2, d1m1td2
    complexed with gol, so4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1m1tc1

PDB Entry: 1m1t (more details), 1.94 Å

PDB Description: biosynthetic thiolase, q64a mutant
PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m1tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1tc1 c.95.1.1 (C:1-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
geganparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1m1tc1:

Click to download the PDB-style file with coordinates for d1m1tc1.
(The format of our PDB-style files is described here.)

Timeline for d1m1tc1: