SCOP 1.63: Domain d1m1oc2: 1m1o C:269-392

Lineage for d1m1oc2 (1m1o C:269-392)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (10 PDB entries)

8. Domain d1m1oc2: 1m1o C:269-392 [78430]

Details for d1m1oc2

PDB Entry: 1m1o, 1.95 Å

PDB Description: crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa

SCOP Domain Sequences for d1m1oc2:

Sequence; same for both SEQRES and ATOM records:

>d1m1oc2 c.95.1.1 (C:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d1m1oc2:

• d1m1oc2 is new in SCOP 1.63
  
• d1m1oc2 appears in SCOP 1.65
  
• d1m1oc2 appears in the current release, SCOPe 2.08