Lineage for d1m1ob2 (1m1o B:269-392)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495384Protein Biosynthetic thiolase [53905] (1 species)
  7. 495385Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries)
  8. 495453Domain d1m1ob2: 1m1o B:269-392 [78428]

Details for d1m1ob2

PDB Entry: 1m1o (more details), 1.95 Å

PDB Description: crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa

SCOP Domain Sequences for d1m1ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ob2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOP Domain Coordinates for d1m1ob2:

Click to download the PDB-style file with coordinates for d1m1ob2.
(The format of our PDB-style files is described here.)

Timeline for d1m1ob2: