SCOPe 2.08: Domain d1m1oa1: 1m1o A:3-268

Lineage for d1m1oa1 (1m1o A:3-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
   Uniprot P07097

8. Domain d1m1oa1: 1m1o A:3-268 [78425]
   Other proteins in same PDB: d1m1oa2, d1m1ob2, d1m1oc2, d1m1od2
   complexed with caa, so4; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1m1oa1

PDB Entry: 1m1o, 1.95 Å

PDB Description: crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa

PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m1oa1:

Sequence; same for both SEQRES and ATOM records:

>d1m1oa1 c.95.1.1 (A:3-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
psiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpage
gqnparqaamkagvpqeatawgmnqlagsglravalgmqqiatgdasiivaggmesmsma
phcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavas
qnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvt
agnasglndgaaaallmseaeasrrg

Timeline for d1m1oa1:

• d1m1oa1 first appeared in SCOP 1.63
  
• d1m1oa1 appears in SCOPe 2.07