Lineage for d1m1ne_ (1m1n E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143392Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2143393Species Azotobacter vinelandii [TaxId:354] [81398] (14 PDB entries)
  8. 2143396Domain d1m1ne_: 1m1n E: [78421]
    Other proteins in same PDB: d1m1nb_, d1m1nd_, d1m1nf_, d1m1nh_
    complexed with ca, cfn, clf, hca

Details for d1m1ne_

PDB Entry: 1m1n (more details), 1.16 Å

PDB Description: Nitrogenase MoFe protein from Azotobacter vinelandii
PDB Compounds: (E:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d1m1ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ne_ c.92.2.3 (E:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d1m1ne_:

Click to download the PDB-style file with coordinates for d1m1ne_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ne_: