Lineage for d1m1ha1 (1m1h A:51-131)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075219Fold b.114: N-utilization substance G protein NusG, insert domain [82003] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 2075220Superfamily b.114.1: N-utilization substance G protein NusG, insert domain [82004] (1 family) (S)
  5. 2075221Family b.114.1.1: N-utilization substance G protein NusG, insert domain [82005] (1 protein)
  6. 2075222Protein N-utilization substance G protein NusG, insert domain [82006] (1 species)
    found only in some NusG species
  7. 2075223Species Aquifex aeolicus [TaxId:63363] [82007] (4 PDB entries)
    interrupted by an insert beta-sandwich domain
  8. 2075224Domain d1m1ha1: 1m1h A:51-131 [78415]
    Other proteins in same PDB: d1m1ha2

Details for d1m1ha1

PDB Entry: 1m1h (more details), 1.95 Å

PDB Description: Crystal structure of Aquifex aeolicus N-utilization substance G (NusG), Space group I222
PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ha1 b.114.1.1 (A:51-131) N-utilization substance G protein NusG, insert domain {Aquifex aeolicus [TaxId: 63363]}
eekvviraqgkekyrlslkgnardisvlgkkgvttfriengevkvvesvegdtcvnappi
skpgqkitckenkteakivld

SCOPe Domain Coordinates for d1m1ha1:

Click to download the PDB-style file with coordinates for d1m1ha1.
(The format of our PDB-style files is described here.)

Timeline for d1m1ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m1ha2