SCOPe 2.08: Domain d1m1gc2: 1m1g C:191-248

Lineage for d1m1gc2 (1m1g C:191-248)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)

6. Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [82074] (3 PDB entries)

8. Domain d1m1gc2: 1m1g C:191-248 [78410]
   Other proteins in same PDB: d1m1ga1, d1m1ga3, d1m1gb1, d1m1gb3, d1m1gc1, d1m1gc3, d1m1gd1, d1m1gd3

Details for d1m1gc2

PDB Entry: 1m1g, 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)

PDB Compounds: (C:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1gc2:

Sequence; same for both SEQRES and ATOM records:

>d1m1gc2 b.34.5.4 (C:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqveki

Timeline for d1m1gc2:

• d1m1gc2 first appeared in SCOP 1.63
  
• d1m1gc2 appears in SCOPe 2.07