Lineage for d1m1ga3 (1m1g A:9-50,A:132-190)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413358Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family) (S)
  5. 413359Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein)
  6. 413360Protein N-utilization substance G protein NusG, N-terminal domain [82681] (2 species)
  7. 413361Species Aquifex aeolicus [TaxId:63363] [82682] (4 PDB entries)
    interrupted by an insert beta-sandwich domain
  8. 413368Domain d1m1ga3: 1m1g A:9-50,A:132-190 [78405]
    Other proteins in same PDB: d1m1ga1, d1m1ga2, d1m1gb1, d1m1gb2, d1m1gc1, d1m1gc2, d1m1gd1, d1m1gd2

Details for d1m1ga3

PDB Entry: 1m1g (more details), 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)

SCOP Domain Sequences for d1m1ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ga3 d.58.42.1 (A:9-50,A:132-190) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus}
lekkwyalqvepgkeneakenllkvleleglkdlvdevivpaXnkifpgyilikahmndk
llmaiektphvfrpvmvggkpvplkeeevqnilnqikrgvkp

SCOP Domain Coordinates for d1m1ga3:

Click to download the PDB-style file with coordinates for d1m1ga3.
(The format of our PDB-style files is described here.)

Timeline for d1m1ga3: