SCOPe 2.08: Domain d1m1eb_: 1m1e B:

Lineage for d1m1eb_ (1m1e B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily)
   core: 3 helices; irregular array

4. Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family)
   automatically mapped to Pfam PF06384

5. Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein)

6. Protein beta-catenin-interacting protein ICAT [81732] (1 species)
   consists of a globular N-domain and extended C-terminal tail

7. Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries)
   Uniprot Q9NSA3 8-53

8. Domain d1m1eb_: 1m1e B: [78400]
   Other proteins in same PDB: d1m1ea_
   has additional insertions and/or extensions that are not grouped together

Details for d1m1eb_

PDB Entry: 1m1e, 2.1 Å

PDB Description: Beta-catenin armadillo repeat domain bound to ICAT

PDB Compounds: (B:) icat

SCOPe Domain Sequences for d1m1eb_:

Sequence, based on SEQRES records:

>d1m1eb_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]}
kspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqlsqlpphsidqgaedvv
mafsrseted

Sequence, based on observed residues (ATOM records):

>d1m1eb_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]}
kspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqlsqidqgaedvvmafsr
seted

Timeline for d1m1eb_:

• d1m1eb_ first appeared in SCOP 1.63
  
• d1m1eb_ appears in SCOPe 2.07