Lineage for d1m1ea_ (1m1e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006354Species Mouse (Mus musculus) [TaxId:10090] [48374] (13 PDB entries)
  8. 2006358Domain d1m1ea_: 1m1e A: [78399]
    Other proteins in same PDB: d1m1eb_
    complex with ICAT

Details for d1m1ea_

PDB Entry: 1m1e (more details), 2.1 Å

PDB Description: Beta-catenin armadillo repeat domain bound to ICAT
PDB Compounds: (A:) beta-catenin

SCOPe Domain Sequences for d1m1ea_:

Sequence, based on SEQRES records: (download)

>d1m1ea_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeiv
egctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaea
ieaegatapltellhsrnegvatyaaavlfrmsedkpqdyk

Sequence, based on observed residues (ATOM records): (download)

>d1m1ea_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrqfvegvrmeeivegctgalhi
lardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatap
ltellhsrnegvatyaaavlfrmsedkpqdyk

SCOPe Domain Coordinates for d1m1ea_:

Click to download the PDB-style file with coordinates for d1m1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m1eb_