Lineage for d1m1da_ (1m1d A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1426909Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 1426915Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. 1426918Domain d1m1da_: 1m1d A: [78397]
    complex with bisubstrate analog inhibitor

Details for d1m1da_

PDB Entry: 1m1d (more details), 2.2 Å

PDB Description: tetrahymena gcn5 with bound bisubstrate analog inhibitor
PDB Compounds: (A:) tgcn5 histone acetyl transferase

SCOPe Domain Sequences for d1m1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1da_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

SCOPe Domain Coordinates for d1m1da_:

Click to download the PDB-style file with coordinates for d1m1da_.
(The format of our PDB-style files is described here.)

Timeline for d1m1da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m1dc_