Lineage for d1m1af_ (1m1a F:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279050Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 279136Protein Histone H4 [47125] (4 species)
  7. 279137Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (7 PDB entries)
  8. 279147Domain d1m1af_: 1m1a F: [78392]
    Other proteins in same PDB: d1m1aa_, d1m1ac_, d1m1ad_, d1m1ae_, d1m1ag_, d1m1ah_
    complexed with abu, bal, dib, imt, mn, pyb

Details for d1m1af_

PDB Entry: 1m1a (more details), 2.65 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

SCOP Domain Sequences for d1m1af_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1af_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)}
lgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirda
vtytehakrktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1m1af_:

Click to download the PDB-style file with coordinates for d1m1af_.
(The format of our PDB-style files is described here.)

Timeline for d1m1af_: