Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (5 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (27 PDB entries) |
Domain d1m19e_: 1m19 E: [78383] Other proteins in same PDB: d1m19b_, d1m19c_, d1m19d_, d1m19f_, d1m19g_, d1m19h_ complexed with abu, bal, dib, imt, mn, pyb |
PDB Entry: 1m19 (more details), 2.3 Å
SCOP Domain Sequences for d1m19e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m19e_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease aylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1m19e_: