Class a: All alpha proteins [46456] (171 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (3 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries) |
Domain d1m18h_: 1m18 H: [78378] Other proteins in same PDB: d1m18a_, d1m18b_, d1m18c_, d1m18e_, d1m18f_, d1m18g_ complexed with abu, bal, dib, imt, mn, pyb |
PDB Entry: 1m18 (more details), 2.45 Å
SCOP Domain Sequences for d1m18h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m18h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)} trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits reiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1m18h_: