Lineage for d1m18c_ (1m18 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987255Protein Histone H2A [47115] (6 species)
  7. 1987256Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)
  8. 1987269Domain d1m18c_: 1m18 C: [78373]
    Other proteins in same PDB: d1m18a_, d1m18b_, d1m18d_, d1m18e_, d1m18f_, d1m18h_
    protein/DNA complex; complexed with 1sz, mn

Details for d1m18c_

PDB Entry: 1m18 (more details), 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna
PDB Compounds: (C:) histone h2a.1

SCOPe Domain Sequences for d1m18c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m18c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOPe Domain Coordinates for d1m18c_:

Click to download the PDB-style file with coordinates for d1m18c_.
(The format of our PDB-style files is described here.)

Timeline for d1m18c_: