Lineage for d1m18a_ (1m18 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764992Protein Histone H3 [47122] (5 species)
  7. 764993Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (27 PDB entries)
  8. 765006Domain d1m18a_: 1m18 A: [78371]
    Other proteins in same PDB: d1m18b_, d1m18c_, d1m18d_, d1m18f_, d1m18g_, d1m18h_

Details for d1m18a_

PDB Entry: 1m18 (more details), 2.45 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna
PDB Compounds: (A:) Histone H3.2

SCOP Domain Sequences for d1m18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m18a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1m18a_:

Click to download the PDB-style file with coordinates for d1m18a_.
(The format of our PDB-style files is described here.)

Timeline for d1m18a_: