Lineage for d1m17a_ (1m17 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 263016Family d.144.1.2: Tyrosine kinase [56150] (15 proteins)
  6. 263045Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
  7. 263046Species Human (Homo sapiens) [TaxId:9606] [82796] (2 PDB entries)
  8. 263048Domain d1m17a_: 1m17 A: [78370]
    complexed with aq4

Details for d1m17a_

PDB Entry: 1m17 (more details), 2.6 Å

PDB Description: Epidermal Growth Factor Receptor tyrosine kinase domain with 4-anilinoquinazoline inhibitor erlotinib
PDB Compounds: (A:)

SCOP Domain Sequences for d1m17a_:

Sequence, based on SEQRES records: (download)

>d1m17a_ d.144.1.2 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens)}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
nfyralmdeedmddvvdadeylip

Sequence, based on observed residues (ATOM records): (download)

>d1m17a_ d.144.1.2 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens)}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlmdeedm
ddvvdadeylip

SCOP Domain Coordinates for d1m17a_:

Click to download the PDB-style file with coordinates for d1m17a_.
(The format of our PDB-style files is described here.)

Timeline for d1m17a_: