Lineage for d1m0ub1 (1m0u B:123-249)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326548Protein Class sigma GST [81351] (5 species)
  7. 2326549Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81771] (1 PDB entry)
  8. 2326551Domain d1m0ub1: 1m0u B:123-249 [78361]
    Other proteins in same PDB: d1m0ua2, d1m0ub2
    complexed with gsh, so4

Details for d1m0ub1

PDB Entry: 1m0u (more details), 1.75 Å

PDB Description: Crystal Structure of the Drosophila Glutathione S-transferase-2 in Complex with Glutathione
PDB Compounds: (B:) GST2 gene product

SCOPe Domain Sequences for d1m0ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0ub1 a.45.1.1 (B:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lcgatpwedlqidivvdtindfrlkiavvsyepedeikekklvtlnaevipfylekleqt
vkdndghlalgkltwadvyfagitdymnymvkrdllepypalrgvvdavnalepikawie
krpvtev

SCOPe Domain Coordinates for d1m0ub1:

Click to download the PDB-style file with coordinates for d1m0ub1.
(The format of our PDB-style files is described here.)

Timeline for d1m0ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0ub2