Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein) circularly permuted version of prokaryotic enzyme |
Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82378] (2 PDB entries) |
Domain d1m0tb1: 1m0t B:1214-1323 [78357] Other proteins in same PDB: d1m0ta2, d1m0tb2 complexed with so4 |
PDB Entry: 1m0t (more details), 2.3 Å
SCOP Domain Sequences for d1m0tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0tb1 c.30.1.4 (B:1214-1323) Eukaryotic glutathione synthetase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae)} ttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfir dteqeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgs
Timeline for d1m0tb1: