| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) ![]() |
| Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) |
| Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species) |
| Species Haemophilus influenzae [TaxId:727] [82688] (1 PDB entry) |
| Domain d1m0sb2: 1m0s B:127-198 [78354] Other proteins in same PDB: d1m0sa1, d1m0sb1 complexed with cit |
PDB Entry: 1m0s (more details), 1.9 Å
SCOPe Domain Sequences for d1m0sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0sb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Haemophilus influenzae [TaxId: 727]}
gstfplpvevipmarsqvgrklaalggspeyregvvtdngnvildvhnfsilnpveieke
lnnvagvvtngi
Timeline for d1m0sb2: